PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.011G115600.1
Common NamePHAVU_011G115600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family VOZ
Protein Properties Length: 451aa    MW: 50163.1 Da    PI: 5.6263
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.011G115600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ432.75.3e-1332064221217
                 VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwn 91 
                         pppsafl+pkcalwdc+rpaqg+ew+q+ycss+h+ la neglpg+tp+lrp+gi++kdg+lfaa+ ak+qgkevgip+cegaa++kspwn
  Phvul.011G115600.1 206 PPPSAFLAPKCALWDCFRPAQGVEWCQNYCSSCHELLANNEGLPGMTPILRPGGIGVKDGPLFAAVLAKTQGKEVGIPSCEGAASTKSPWN 296
                         89***************************************************************************************** PP

                 VOZ  92 aaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalal 182
                         a+e+fdls+lege++rewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmke+gg+krsyymdpqp+s++ewhlyeyein+ d +al
  Phvul.011G115600.1 297 APEFFDLSFLEGEAVREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMKEHGGQKRSYYMDPQPLSYLEWHLYEYEINNHDGCAL 387
                         ******************************************************************************************* PP

                 VOZ 183 yrlelklvdekksakgkvskdsladlqkklgrlta 217
                         yrlelklvd+kks+kgkv+k+sl+dlq+k+g+lta
  Phvul.011G115600.1 388 YRLELKLVDKKKSPKGKVTKESLNDLQNKMGQLTA 422
                         *********************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MMRESSKGKC GSSSIQSMKE KEKHLVDKIQ GIFSNLQCAR KEGRGNDIVI FEEQMHQLLR  60
EWKAELESPA TSLADGSFDS FTSELAQLLQ VIEEKDDATS PLTKPGPLKT ELQTSNISDN  120
NFQFFQEKHF DGNQHLGHNF ESSASTLYNN AFSNTDMDLG HNTEIKHSES TQFSLEGFDC  180
SQIFGAGDTV QHGENIIPNI LPNICPPPSA FLAPKCALWD CFRPAQGVEW CQNYCSSCHE  240
LLANNEGLPG MTPILRPGGI GVKDGPLFAA VLAKTQGKEV GIPSCEGAAS TKSPWNAPEF  300
FDLSFLEGEA VREWLFFDKP RRAFESGNRK QRSLPDYSGR GWHESRKQVM KEHGGQKRSY  360
YMDPQPLSYL EWHLYEYEIN NHDGCALYRL ELKLVDKKKS PKGKVTKESL NDLQNKMGQL  420
TAAVLSSDDG VPPINGKTNA KSENDGSPEK *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007132681.10.0hypothetical protein PHAVU_011G115600g
SwissprotQ9SGQ01e-158VOZ1_ARATH; Transcription factor VOZ1
TrEMBLV7AHH00.0V7AHH0_PHAVU; Uncharacterized protein
STRINGGLYMA06G43890.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-150vascular plant one zinc finger protein